PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_010140_fqsf.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 217aa    MW: 25255.3 Da    PI: 6.5258
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_010140_fqsf.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.75.4e-27958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krien++nrqvt+skR+ngi+KKA E+ vLCda+v+v+if+++gk++ y 
  Bv1_010140_fqsf.t1  9 KRIENSTNRQVTYSKRKNGIIKKATEITVLCDAKVSVVIFANNGKMHAYN 58
                        79*********************************************996 PP

2K-box78.81.3e-2671169199
               K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeen 91 
                         yq++sg+ l++ak+e+l++e++++kke++ ++ e+Rhl Ged++sL++ +Lq+Le++Le+++++iR+++ e+ ++  +++++ e+e+ + n
  Bv1_010140_fqsf.t1  71 YQNKSGTFLWDAKHENLKNEIDRIKKENDDMRIELRHLSGEDIGSLQYPDLQRLEDALENGVSSIRDRQAEIHKMLEKNQRMLEEENYQLN 161
                         78999999*********************************************************************************** PP

               K-box  92 kaLrkkle 99 
                          +L+k+ +
  Bv1_010140_fqsf.t1 162 YMLHKQEN 169
                         ****9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.09161IPR002100Transcription factor, MADS-box
SMARTSM004323.9E-37160IPR002100Transcription factor, MADS-box
CDDcd002651.81E-36280No hitNo description
SuperFamilySSF554552.09E-34296IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.4E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.7E-1983164IPR002487Transcription factor, K-box
PROSITE profilePS5129714.46284170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT YSKRKNGIIK KATEITVLCD AKVSVVIFAN NGKMHAYNSP  60
STSVEDILNE YQNKSGTFLW DAKHENLKNE IDRIKKENDD MRIELRHLSG EDIGSLQYPD  120
LQRLEDALEN GVSSIRDRQA EIHKMLEKNQ RMLEEENYQL NYMLHKQENE LMDGGSISRA  180
EMDGGVRNIP QDQRDYNYHN PFGFRVQPMQ PNLQDRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-15175173Myocyte-specific enhancer factor 2B
1tqe_R4e-15175173Myocyte-specific enhancer factor 2B
1tqe_Q4e-15175173Myocyte-specific enhancer factor 2B
1tqe_P4e-15175173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677653.11e-161PREDICTED: floral homeotic protein PMADS 2-like
SwissprotQ074744e-91MADS2_PETHY; Floral homeotic protein PMADS 2
TrEMBLA0A0J8FWB11e-161A0A0J8FWB1_BETVU; Uncharacterized protein
STRINGVIT_18s0001g01760.t015e-94(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.17e-77MIKC_MADS family protein